TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q82VN5|Q82VN5_NITEU Putative iron transport system ATP-binding protein OS=Nitrosomonas europaea GN=NE1031 PE=4 SV=1
MSTLLELDRISHAYGAQVIVNELSFELEKGEIGCLLGPSGCGKTTVLRCIAGFEPIVSGEIRLNEISVSRAGFVLPPEQR
RVGMVFQEYALFPHLTVTANVGFGLHRSTKAERAHRVAELLQITGLMEVANRYPHELSGGQQQRVALVRALAPYPDLILL
DEPFSNLDVSLREYLGQEIRELLKKLNITAILVTHDQAEAFAVADKIGVMHAGKMMQWGSAHELYHHPANRFIADFIGQG
TLIPGKVTHSDKVETELGTLAGNIYHPGHSSREIAGSQVDVLIRPDDVIHDNDSSLRAVVVHKAFRGAQFLYTLRLASGQ
SVLSLISSHHDHAIGEKIGIRPQTDHIVVFDRVNSQ