TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q82VN6|Q82VN6_NITEU Iron transport system permease protein OS=Nitrosomonas europaea GN=NE1030 PE=3 SV=1
MVLVPVCVVFASFLSPDDEIWQHLISTTLPSLLTNTLWLSLGVIVGTSLLGVSLAWFTSVYRFPGYRFFSWALFLPLAIP
AYVIAFVALGTFDYTGPVQTSLRHWFNSDLLWFPDIRSGPGVAIVMTLAFYPYVYLLSRDAFLTQGKRLLEVAQSLGFTR
QQGFFRVVLPMARPWIVAGIMLALMETLADFGTVSIFNYDTFTTAIYKTWFGMFSLSTASQLASLLILIVLVIIMTEQRF
RLRMRFSESRKSARVERIPLTGWQAMAVTGFAGTVLFFAFALPIIQLGIWAMDALTIGLDQRYLEFAWHSILLSVLAALI
TCLVAAMLAYAARLHSDGYTRFAIRLTTVGYALPGAVLAVGIFIPMAWLDNLLSDWIENISGVETGLLIQGTLTVMLVAY
MTRFLAVSYFPLESALQRVTRSIDEAAAGFGVTGWSMLRMIYFPMLKSSLFTAATLVFVDVMKEMPITLMTRPFDWDTLA
VRIFSLTSEGQWDQAALPALTLILTGLIPIILLIRHSET