TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q832J9|Q832J9_ENTFA ABC transporter, ATP-binding/permease protein OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_2227 PE=4 SV=1
MKKTMNLQSFKRFWKMIKPEHPIFYGLMICSLIGNLLIVAMTYIMAIGIDNLLEAIKRVGLKGMTLPLVEEALLGPVLLL
ILFSIISSITSFIQERAMASLSERVTLRIRKEVTKKFKTLPMAFFDNHQVGDIISRSTTGLNQLSQVLLTGINQFFTSVV
TILFAGIMLFYIDAKLTILVLLLIGGSTFMTTKIANKNKVFADQSQAELGQLNNKMEEYLAGNLVTKTFNQQQNAEKTID
AVNQQHYRAFKKAQFLNFAIYPAIRFINQLAFIISAILGAMLVLSGGITIGFLQAYLQYINQISEPISTASYVINSIQAA
MASIDRIFVILDEADEQPEATHLETISSPKGAIEFKNVQFGYTPEKILMKNVDFSVQPKKTVAIVGPTGAGKTTLVNLLM
RFYEINQGAITFDGIDITKLSRQNLRNLFGMVLQNTWLFEGTVADNIAYGKKDASREEIIEAAKIAQCDHFIRTLPQGYD
TIISSENGALSQGQQQLLTIARIILANPPVVILDEATSSVDTRTEAHIQKAMETVTENRTSFVIAHRLSTIENADLILVM
KNGDIIEKGTHQELLQAPTLYASLYNSQFQTT