TCDB is operated by the Saier Lab Bioinformatics Group
>Q84GI9|Q84GI9_SERMA Putative resistance-nodulation cell division protein SdeB - Serratia marcescens subsp. marcescens.
MDFSRFFIDRPIFAAVLSILIFVAGVIAIPLLPISEYPDVVPPSVQVRAEYPGANPKEIAETVATPLEEAINGVENMMYM
KSVAGSDGVLVTTVTFRPGTDPDQAQVQVQNRVAQAEARLPEDVRRQGITTQKQSPALTLVVHLVSPSGKYDSLYLRNYA
TLKVKDELARLPGVGQVQIFGAGEYAMRIWLDPNKVAARGLTASDVVSAMQEQNVQVSAGQLGAEPMPTRSDYLLSINAQ
GRLQTEEEFGNIILKSGDNGEIVRLRDVARIEMGSGSYALRAQLNNKDAVGIGIFQSPGANAIELSDAVRGKMAELATRF
PDGMSWKSPYDPTVFVRDSIRAVVDTLLEAVILVVLVVILFLQTWRASIIPLLAVPISVVGTFAALYLLGFSLNTLSLFG
LVLAIGIVVDDAIVVVENVERNIEEGLSPLAAAHQAMREVSGPIIAIAVVLCAVFVPMAFLSGVTGQFYKQFAVTIAIST
VISAINSLNLSPALAARLLKPHGAPKDMPSRLIDRLFGWLFRPFNRFFASGSQRYQRGVSRVLGRRGAVFIVYLLLLAAA
GVMFKTVPGGFIPTQDKLYLIGGVKMPEGASLERTDAVIRKMSAIGMSVDGVTDAVAFPGLNALQFTNTPNTGTVFFALE
SLSTRTRTAAQINAEINARISQIQEGFAFSIMPPPILGIGQGSGYSLYVQDRGGLGYGALQTAINTMSGAIMQTPGMGFP
ISSYQANVGQRDAKIDRDKAKAQGVPLNALFSTLQTYLGSSYINDFNRYGRTWKVMAQADAQFRDSVEDIANLRTRNDKG
EMVPIGSMVSIGTTYGPDPVIRYNGFPAADLIGDADPRVLSSTQAMGALTQMADKLLPNGMNIQWTDLSYQQSTQGNAAL
VVFPVAVLLAFLALAALYESWTLPLAVILIVPMTMLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELEM
QGKGIVEAALEACRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVTLFGLFLTPVFYVTLRRLVAR
KAQPQTA