TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q859D9|Q859D9_9CAUD Putative lysis protein OS=Pseudomonas phage gh-1 GN=17.5 PE=4 SV=1
MAGLEIDFTNGVVRAAPIAAGAGAEVASQVAGMTLSDWFYAAIIFYTIVQTIVLVFKTVMDEKRKNKGDGP