TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q86DE1 Hydrogenosomal carrier protein (Fragment) - Trichomonas gallinae.
QILIATSPKPSLSPVERLSVGFIAGTLSRTLTSPLDVVKMLMQVSSRGGSVKDTISKLMAEQGIAGFWRGNWAACIRLGP
QSAIKFYTYEELEKRIGKGKPLVGFQRTIFGSLSGVISQVLTYPLDVIRTRITVYPGKYTGIFNCAFTMMKEEDFSSLYA
GIVPTVMGVIPYEGAQFYAYGGLKQLYTTRIAPGKPISPFANCLIGAAAGMFSQTFSYLFDVIRKRMMLKGEKGKPIYNG
MIDAFMTVYNKEGVPGLYRGVGLNLIKVVPFAALQFTILEETRKAFFKVRAAINQPKVEEIKGKV