TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q87LZ1|OMPU_VIBPA Outer membrane protein U OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=ompU PE=3 SV=1
MKKTLIALSVSAAAMATGVNAAELYNQDGTSLEMGGRAEARLSMKDGDAQDNSRIRLNFLGTQAINDNLYGVGFWEGEFT
TNEQGGVDGDVNKDSSNLDTRYAYAGLGGAWGEFTYGKNEGALGVITDFTDIMAYHGNSAADKLAVADRSDNMMSYKGQF
ENLSVKASYRFADRKLNDAGTEYTDNGQDGYSLSAIYAVADTGLELGAGYADQDEANEYMLAASYTMGDLYFAGIFTDGE
KAKTEGDYTGYELAGAYTLGQTVFTTTYNNAETNNETSANNFAVDASYYFKPNFRGYVSYNFNLIDSGDKLGKVGGNTTA
SKADAEDELALGLRYDF