TCDB is operated by the Saier Lab Bioinformatics Group
>Q87SJ8|Q87SJ8_VIBPA Outer membrane protein TolC - Vibrio parahaemolyticus.
MKKLLPLFISAALGGISSSAWADSLAEIYDLAKQNDPQLLSVAAQRDRAFEAITSSRSALLPQINLTAGYNLTRGDTEYD
SNLISDVSNDSNALTAGVNFSQELYNRASWITLDTAEKSARQADATYAAAQQGLILRVSQAYFEVLRAQDNLVFVRAEKA
AVGRQLEQTKQRFEVGLSAITDVHDAQAQYDAVLADEVLAENDLINSYESLREITGQEHKNLNVLDTNRFSATRTNSPAE
TLIDEAKTKNLSLLSARISQDIARDNISLASSGHLPTLSLDGGYNYGDTSNSARDNTTDNFNIGVNLAVPLYTGGNVTSQ
TKQAEFAYVAASEDLEAQYRSVVKDVRAQNNNINASIGALKAYEQSVVSARSALEATEAGFDVGTRTIVDVLDATRRLYD
ANKNLSDARYNYILSVLQLRQAVGTLSEQDILDVDAGLKPAK