TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q88FY7|NICP_PSEPK Porin-like protein NicP OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) OX=160488 GN=nicP PE=2 SV=1
MQGFTAPRFSSSARLAGGCIAAALCAEATAEEAGFIEGARATLQARNYFFSRDYADIKGASTQSRTQEWAQGFILNASSG
YTQGTLGVGVDVTGLLGFKLDSSPEHARSGLLPSLDSGKSADEYSRLGAAIKFKVSQTELKVGELMPNLPVLLFSDLRLL
PPTYQGAMLESREFAGLTLSAGQFRSTSLRDSSNSQKMYALVNDPINPARLARFTSDRFNYVGADYAFNDNRTSVGVWQA
QLEDIYQQRFYSFKHAEPLGSWTLGVNAGYFDAREDGSKVAGDYDNHALFSLFSAKTGGHTFYVGYQQIGGDDGFIQVGA
NTNPMGNTLPTYEFSAPGERSWQVRHDYNFVALGLPGLTSTLRYVKGRDVETGLGFEGRDRERDLDLAYVVQSGPLAGLG
IRVRNVMARSNYRTDIDENRLILSYTIKVF