TCDB is operated by the Saier Lab Bioinformatics Group
>Q88RT4|Q88RT4_PSEPK Cobalt/zinc/cadmium efflux RND transporter, outer membrane protein, CzcC family - Pseudomonas putida (strain KT2440).
MPRYNRNVLPKTPVSPWKIAALCAVISGLMAPAALAQSISLPQALSTAMDANPDLAAARQEIGIADGARKQAGLIPNPTI
SYDVEDTRRNTSQTTVSLSQTLELGGKRGARVDVATYGQTAAQLELDRRVNGLRADVVQAFYAALRAQTGLDLAKQSLEL
TERGLRIVDGRVRAGKSSPVEATRAQVQLAEAQLQVRRAETEKATAYQQLAQITGSSVTVFDRLESPTLSPGLPPRTEDL
LAKLDQTAEMRQAVVQIDKSDASLGSEKAQRIPNLTVSVGSQYDRSVRERVNTVGLSMPLPLFDRNQGNILSASRRADQA
RDQRNAVELRLRTETQTALNQWSTAMQEVESYDKTILPSAQQAVETATRGFEMGKFGFIEVLDAQRTLIVARGQYLESLA
AATNARAQVERVYGEVGSTAGTR