TCDB is operated by the Saier Lab Bioinformatics Group
>Q88RT6|Q88RT6_PSEPK Cobalt/zinc/cadmium efflux RND transporter, permease protein, CzcA family - Pseudomonas putida (strain KT2440).
MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITNVQVQINTAAPGYSPLETEQRITFPVETAMAGLPGLQ
QTRSLSRSGLSQVTVIFKDGTDIFFARQLINERLQVAKEQLPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTP
TDLRVIQDWIIKPQLRNVPGVAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALESNNANVGAGYIERNGEQLLIRA
PGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKELRTGAATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTL
PKGVVAVTVYDRTNLVEKAIATVKKNLVEGAILVIAILFLFLGNIRAALITAMVIPLSMLFTFTGMFNNKVSANLMSLGA
LDFGIIVDGAVVIVENAIRRLAHAQHKHGRMLTKTERFHEVFAAAREARRPLIFGQLIIMVVYLPIFALTGVEGKMFHPM
AFTVVMALLGAMVLSVTFVPAAIAMFVTGKVKEEEGVVMRTARLRYEPVLQWVLGHRNIAFSAAVALVVLSGLLASRMGS
EFIPSLSEGDFAMQAMRVPGTSLTQSVEMQQRLEKAVIAQVPEVERMFARSGTAEIASDPMPPNASDAYIMLKPQDQWPN
PKKPRDELIAEVQKAAAGVPGSNYELSQPIQLRFNELISGVRSDVAVKVFGDDMDVLNNTANKIAAALKAVPGSSEVKVE
QTSGLPVLTINIDREKAARYGLNIADVQNSIAIAVGGRQAGTLYEGDRRFDMVVRLPETVRTDVAGMSSLLIPVPANAAQ
GANQIGFIPLSQVANLDLQLGPNQISRENGKRLVIVSANVRGRDLGSFVEEATASLDKKVQIPAGYWTTWGGQFEQLQSA
AKRLQIVVPVALLLVMTLLFLMFNNLKDGMLVFTGIPFALTGGVVALWLRDIPLSISAGVGFIALSGVAVLNGLVMIAFI
RGLREEGRTLRQAVDEGALTRLRPVLMTALVASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPALYHWAH
RKDEDGDEAEVVS