TCDB is operated by the Saier Lab Bioinformatics Group
>Q8BQU6|CXA12_MOUSE Gap junction alpha-12 protein - Mus musculus (Mouse).
MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQSKFTCNTRQPGCDNVCYDAFAPLSHVRFW
VFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGTRRLPRAQLPPPPPGWPDTTDLGEAEPILALEEDEDEEPGA
PEGPGEDTEEERAEDVAAKGGGGDGKTVVTPGPAGQHDGRRRIQREGLMRVYVAQLVVRAAFEVAFLVGQYLLYGFEVPP
FFACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRGRRGASAAGPGPTPRPPPCAFP
AAAAGLACPPDYSLVVRAAERARAHDQNLANLALQALRDGAAVAAVSADRDSPPCAGLNATSRGAPRVGGLASGTGSATS
GGTVGEQSRPGAQEQLATKPRAGSEKGSTGSRDGKATVWI