TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8DQ76|Q8DQ76_STRR6 Putative uncharacterized protein ABC-MSD OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ABC-MSD PE=4 SV=1
MFRLTNKLAVSNLIKNRKLYYPFALAVLLAVTVTYLFYSLTFNPKIAEIRGGTTIQATLGFGMFVVTLASAIIVLYANSF
VMKNRSKELGIYGMLGLEKRHLISMTFKELVVFGILTVGAGIGIGALFDKLIFAFLLKLMKLKVELVATFQTKVVITVLV
VFGLIFLGLMFLNALRIARMNALQLSREKASGEKKGRFLPLQTILGSISLGIGYYLALTVKDPLTALTTFFIAVLLVIFG
TYLLFNAGITVFLQILKKNKKYYYQPNNLISVSNLIFRMKKNAVGLATIAILSTMVLVTMSAATSIFNSSESFKKVLNPH
DFGVSGQNVEKEDLDKLLSQFASDKGYKIKEKEVFRYTYFAVANQEGTKLTIFEKGQNRVQPKTVFMVFDQKDYENMTGQ
KLSLSGNEVGLFAKNEGVKEQKALTLNDHQFSVKEEFTKDFIVNHVPNQFNILTADYNYLVVPDLQAFLDQFPDSAIYNQ
FYGGMNVNASEAEQLKVAEEYEKYLQKFNAQLNTEGNYVYGSTLADASAQMSALFGGVFFIGIFLSIIFMVGTVLVIYYK
QISEGYEDRERFIILQKVGLDQKQIKQTINKQVLTVFFLPLLFAFLHLAFAYHMLSLILKVIGVLDTTMMLIVTLSICAI
FLIAYVLIFMITSRSYRKIVQM