TCDB is operated by the Saier Lab Bioinformatics Group
>Q8DT28|Q8DT28_STRMU Putative maltose/maltodextrin ABC transporter, sugar-binding protein MalX - Streptococcus mutans.
MKTWQKIVVGGAGLMLASSILVACGSKDSKSSSSDPKTIKLWVPTGAKKSYQSIVHKFEKDSNYKVKIIESEDPKAQEKI
KKDPSTAADVFSLPHDQLGQLVDSGVIQEIPQKYSKEINKNETQQAATGAMYKGKTYAFPFGIESQVLYYNKSKLSADDV
TSYETITSKATFGAKFKQVNAYATAPLFYSVGDTLFGKNGEDAKGTNWGNDAGVSVLKWIASQKGNAGFVNLDDNNVMSK
FGDGSVASFESGPWDYEAAQKAVGKNNLGVTVYPTININGQEVQQKAFLGVKLYAVNQAPSKGNTKRIAASYKLASYLTS
AESQENQFKTKGRNIIPSNKTVQNSDTVKNHELAQAVIQMGSSSDYTVVMPKLNQMSTFWTESAAILSDTYNGKIKESDY
LAKLKQFDKDLAAAK