TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F3N1|Q8F3N1_LEPIN Uncharacterized protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_2370 PE=4 SV=1
MITNNNSLKILVSKFSVRRGFNLIEVSIALALAGIAMTYTYMVISNGIKQQRMATVISNAVHLAKIKMAQIDSVSVLQSD
KTTGDIPGYPGYGFETSINEEDMDLLKLSGKDSQKPEDLLGGRDSEMNKLIMRRSGQASQGAATAGIIRVFRIKVTIKYP
TGSGTESYTAETFKSAQY