TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F605|Q8F605_LEPIN Putative uncharacterized protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_1507 PE=4 SV=2
MNLFRLVLKYRNRKSMKKFLIFVSFVISLFFVTTGAVYGQQEDCSKLAFMDDVQRKPRTDLPFPISEMRRLRPEDICKKK
EGWFPTGLPLLNSDPNVGVGYGVRVFLINNGKKSDPFFEYAPYRFRMFAQYFNTTKNRQYQDISFDAPYIFDTKWRLRGD
LIYDTNPNTLYYGIGERSLETLSYQERNQSGGEVVRNATYHEREKNIYFTRPGGPGDPVDFQGTNYSGFPNNDAFRVTDR
MYNRYDIRSPQANLSGEHIFFGGLVRAVAGIRVSQNIIKTFDGQFVKSTDPLTEGTPFSNSGITPNGKTKVTEDAEAGKI
IGANGGNVNSVRFGLVLDTRDLEPDPNRGMFVEATYEKVAKAFGSDFQYSKYFTQVKLFYSPFPKVFDKLVIAGRGAFGL
TEGDAPFFEYRNLWSTEGGITGLGGLRTLRGYKQDRFAGKAMGWGNIELRWKFFDFNIAGQHFALNLVPFMDFGRVWDDE
HNVGLKDYKYSRGLGFRIAWNQSTILMLDYAVSKEDKQVFMNFNHIF