TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8GC82|Q8GC82_ENTAE EefC outer membrane protein - Enterobacter aerogenes (Aerobacter aerogenes).
MFRLSLMFIALLTAGCVSLDPHYERPAAPVPATLPGAHGESTAVVGDWQKVVNDARLKKVVSIALNSNRDVQKALADIEA
ARAQYGETRASLFPTVDAELSHTRSKTIASGLSSTSQADGAVSSFELDLFGKNQSLSRAARESWLASEFTAQNTRLTMIA
DLTTAWVTLATDNSNLALAQQTMDSAENSRKIVARQMAVGTASAGDLSSAESVYQQARASVASYRTLVAQDKNAINLLAG
ETVPESLLPGTLESLGDNSITLVPAGVSSSVLLRRPDIQEAEHNLKSANADIGAARANFFPSISLTASAGVGSDSLSSLF
SHGMQVWSFAPSISLPLFTGGSNLAQLRYAQAEKKGLIATYEKSIQSAFKDVADALARRETLSEQLDAQQQYVAAEQKSL
DIAMKSYQAGVGDYLSVLTAQRTLWSAKATLLSLQQTDLNNRITLWQSLGGGAS