TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8I4G4|Q8I4G4_CAEEL Protein KCNL-2, isoform c OS=Caenorhabditis elegans GN=kcnl-2 PE=2 SV=1
MLGSPVADNPDDPLLNGSSAPKSILRAPRLTAAPKQLSFDVPASPTPTAKSSCVSTSGSYHMFERPNRLRAGKFSYGGLT
SNHPHNQGHIQLTANGTPVFAYSGGGGGSCAVSPSSSARREDPSKWRLSDLKQRSNSESMFRNFDHELLADGGRRMSMAY
LPSREQALLRRILGPQGLSWISHDRETASRKSVSIAYSNDLEAGGKGNGAIGDDSTVPLMDEKDDNSGGRLIRREILHEK
RRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVAL
SFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNR
VNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCG
RSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKH
QRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELLRGS
NEQRKKSVVIGGESAPPTPQQILKRKIGELRV