TCDB is operated by the Saier Lab Bioinformatics Group
>Q8JFD6|Q8JFD6_DANRE Gap junction protein - Danio rerio (Zebrafish) (Brachydanio rerio).
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQSMFVCNTLQPGCNQACYDKAFPISHIRYWV
FQIIMVCTPSLCFITYSVHQSAKQKERRYSTIYLSLDKDPDTMRRDDSKKIKNTIVNGVLQNTENSTKESEPDCLEVKEI
PNSAMRTTKSKMRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFNVPAVYECDRYPCIKDVECYVSRPTEKTVFLVFM
FAVSGICVVLNLAELNHLGWRKIKTAVRGVQARRKSIYEIRNKDLPRMSMPNFGRTQSSDSAYV