TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8K8K8|METN_STRP3 Methionine import ATP-binding protein metN OS=Streptococcus pyogenes serotype M3 GN=metN PE=3 SV=1
MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTNGKITVDGDVTFEQGKVQ
LSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAI
ARALANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGVLIEEGSVLDIFSN
PKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQLKYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVG
DMIVVLEGQAENILAAEKALHEAGVDVSILKRGA