TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8NKG7|Q8NKG7_ACRCH Multidrug resistant protein OS=Acremonium chrysogenum GN=cefT PE=4 SV=1
MANNSGTTTVQLDDVLERSSTLNTLNNIDTVQHHEPRTSFANNRQQAPAGGSSQSDATVGPRHKLVTFAPDDPENPKNWS
KAYKWYCTLVVSLTCFVVAFASSVISADIDGVMEEFNVSETAALVSISVFVVGFGVGPMVFAPLSEVYGRRIIYGSKLLF
AVIFVIPCAVSKNLGTLLACRAIDGIAFSAPMTLVGGTLADMWKNEERGVPMAAFSAAPFAGPAIGPLVGGYLSDAAGWR
WLYWIQLILSGIIWILITFTVPETYAPTILAKRARKLRKSTGDPNHVTEQELDPRPISEQLRVFLTRPFQLLFGELIVLL
ISLYMSVLYGLLYMFFIAYPIVYKGGKGYSSGKTGLMFIPVAVGVVLSACCSPFVNTHYISLAHFHGGKPPAEVRLIPMM
LSCWLIPIGLFIFAWTSYPWLSWAGPAMGGFPVGFGFIFLYNSANNYLVDSYQHQAASALAAKTFIRSFWGAGVVLFTKQ
MYSRLGDQWASSLIAFLALACCAIPFLFWKYGARIRARSKYAYAGDETPADVEKAKQRPAEAGVLADADDLRRAISYVSN
P