TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein metN OS=Corynebacterium glutamicum GN=metN PE=3 SV=1
MSHTASTPTPEEYSAQQPSTQGTRVEFRGITKVFSNNKSAKTTALDNVTLTVEPGEVIGIIGYSGAGKSTLVRLINGLDS
PTSGSLLLNGTDIVGMPESKLRKLRSNIGMIFQQFNLFQSRTAAGNVEYPLEVAKMDKAARKARVQEMLEFVGLGDKGKN
YPEQLSGGQKQRVGIARALATNPTLLLADEATSALDPETTHEVLELLRKVNRELGITIVVITHEMEVVRSIADKVAVMES
GKVVEYGSVYEVFSNPQTQVAQKFVATALRNTPDQVESEDLLSHEGRLFTIDLTETSGFFAATARAAEQGAFVNIVHGGV
TTLQRQSFGKMTVRLTGNTAAIEEFYQTLTKTTTIKEITR