TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8P5Q7|Q8P5Q7_XANCP TonB-dependent receptor OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) GN=fhuA PE=3 SV=1
MRKRLKTDHLATSVAAALTTLTRRPAAASMALLLGASSLPAIAQEARTLDAVSVVGTGSTRTTASISVAEIQAQVPGVAP
QQLLASLPGVNVQTTDPFGLYEFGDSMTIRGFSANQIGVTLDGIPIETFDTREGGPITRYVSSENLLDVTVSAGSGDVTQ
PSYHALGGAIRYTSLPPKGGDTWSGNLTQTIGSDDLVRSFVRLDTPQWWDGGPSAYVSASRTQGGVWDMEPATQKSDHFE
AKIRQAWDAGSLTLGWIYNNRKDYDVQSYNSDGSVSWDLHERITGNPEVDAEHYSEWQNGRRDSLLSLHGDFLFNDAIGF
TFTGYYENKHGYGVGGTPPSTATGLYNDAIAGTPGRTDIAINDPQIVDAAGNVTRVGAMTRREEIMGGDRYGATTAVSWE
TEHNKLEVGAWYENYDFDQVRPLYNLDPATGALLKSALPIVIYYDNHFSTEVKQLYIKDTLRLLDDRLTLELGAKGLDVK
RDYNGIANLDDFNVGVRRDVTIKNSDWFQPQVGASFQLADGVQVFANYAENFSSAPRLALTSGAFNPDIAPEESTNIDIG
IRAESSQWSGYIAAYKIDYENRIIALTDPDPLVVAPTVYANVGDVQTYGAEVSGMWKPAPGWRLGASLTWNKSEFQDNYF
GPVSGSLVQVEGNEVPDSPKVMFSVNGGWEGENFFANLDTKYTGKRYGDTLNTDQVDATFIVNGSVGYQGGSDGFLAGGR
LQLSVYNLFDKDDAIGAVFPNESSGSYQLIAPRQVFASLSYKF