TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8R8L9|Q8R8L9_CALS4 Cell division protein FtsX OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=FtsX PE=3 SV=1
MLFRNFRYFIKEGFSNLARNRLMTVASVTSVMAALVILGMFLLIILNVNHMAYQVESQLELKAFLKDDLSGEQIQRIGEE
IKGIDGVSSVVFESKEQALQKFKKQLGEKSYLLEGLEKDNPLPQSYIVKVKDANLIKDIADEIKGINGVDKVSYGQDVVE
KLLGIIRIIRIVGLAIISILFVISIVIISNTIKLGVFARRREINIMKYIGATDWFIRWPFLIEGIVLGLLGALLSVGVLA
LMYGYTLDYVNSRLIVFNLLPLSDVIKDMALYFALLGSLIGAIGSGLSIKRFLNV