TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8R9C1|Q8R9C1_THETN Putative uncharacterized protein OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1694 PE=4 SV=1
MKKFYIAAIVIILLTPLGLLAPGSAWGEWGLDEIKSMIGYVPEGMNRFSEVIKAILPDYSIPGFDANFFQQALGYIFLAV
VGIAAIVLMFAILGRIMGKPQKKNG