TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8RMB7|Q8RMB7_SALCH ATP binding cassette transporter-like protein (Putative ATP binding cassette (ABC) transporter) OS=Salmonella choleraesuis GN=iroC PE=3 SV=1
MPATHSPMPARAWIVRLARVCWERKTLSIIVIVASVSTILLAALTPLITRQAVNDAIAGDTTHLPLLACGLLLIALFDFI
GNYVRRGYAGELSLWVQHTLRSRAFDSIQKLDGAGQDALRTGQVISRTNSDLQQVHTLLQMCPVPMAVLTYYVAGIAVML
WMSPSMTLIVICVLAALAITALRARRRVFAQTGLASDRLAHMTEHMREVLEQISVVKSCVAELRETRWLDGQSRQMVRVR
IGAAISQAMPGATMLALPVIGQIVLLCYGGWSVMNGRIDLGTFVAFASFLAMLTGPTRVLASFLVIAQRTQASVERVFAL
IDTRSRMEDGTESVEGQIIGLDVEKMSFHYDNGNRILNEISFSIHAGETVAVVGASGSGKSTLLMLLARFYDPTSGGVWL
NTTTGQQNIRDLKLTALRRRVGVVFEDAFLFAGTVAENIAYGHPQATQDDIRRAADAAGASGFINALPQGFNTRLTERGS
NLSGGQRQRIALARALITAPELLILDDTTSAVDAGTEAEINTALGRYADNEHMLLVIARRRSTLQLADRIVVLDKGRVVD
IGTQAELDARCPTFRSLMSGEGDFLALAPAEQRTLWPTTQAVKSDDAHERQTPAGKGFVDRMTRVPERAVQMALAGHGRQ
VSSLLTPVAWMFVIAALLIALDSAAGVGVLVLLQRGIDSGVAAGDMSTIGICALLALCLVAIGWCCYALQTIFAARAAES
VQHTVRLRSFSHLLRLSLPWHEKHIDSRLTRMTVDVDSLARFLQNGLASAATSIVTMVAIAAAMFWLDPILALTALSAVP
VVMLATWIYRRLSSPAYAQARLEIGKVNSTLQEKVSGMRVVQSHGQQKQEAARLRALSDNFRATRVRAQKYLAVYFPFLT
FCTEAAYAAVLLIGATRVAGGEMTPGILAAFFLLLGQFYGPVQQLSGIVDSWQQATASGKHINALLATEDTENIEPSSIT
PGTGGALRLEALTFRYPEKTQPVLDKLSLTIPPGTVVAVVGRSGAGKSTLIKLLAGLYSPGSGQIRVGERLIDAASLSDY
RRQTGLVTQDVALFSGDIAENIRYPRPNSSDTEVESAARRAGLFETVQHLPLGFRTPVNNGGTDLSAGQRQLIALARAHL
AQAHILLLDEATARIDRSAEERLMTSLTRVTHTEKRIALIVAHRLTTARRCDVIVVIDKGCIAEYGSHEQLIATHGLYAR
LWRDSIGQTRDTQGEVIG