TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8RMY6|Q8RMY6_HELPY Putative VirB10 protein - Helicobacter pylori (Campylobacter pylori).
MKQSLLKKIGLGVGGFVVLMALGLLTNKGSNNNNKEEIFQVSESKFPLSDYFFEEVKEEPKEKAKETPEVTTQEPTTQTS
PNPSVSANPNIKDYSHLNNNLNQQNNTITHLQQVLQSPSKIKPKPKHTKEQLEFLNTRLKPLEPTKPATKPEMEYGVDSF
TNLKYKDIGTNEHKLLRTITADRMIPAFLITPISSQIAGKVTAQVESDIFASMGRAVLIPKGSKVIGYYNNNNQIGQYRL
NIAWTRIITPQGINIMLTNARGADVKGYNGLVGKYISRNFQRYGIPLLTNTLSNGLLIGITSALANRQNRKGDGNPFFGD
YLLMQLTRNTGMGINQVINQMLRQYGAQNPIIIIREGSRVFISPNLDIFIPKPKDGEVLAEFFKEKKPPIKTKEEINNEE
EI