TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8RWA5|Q8RWA5_ARATH Putative uncharacterized protein At1g25380 OS=Arabidopsis thaliana GN=At1g25380 PE=2 SV=1
MIEHGNSTFDYRSIREVAANAGAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMY
RGLSPTIIALLPNWAVYFSVYGKLKDVLQSSDGKLSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPGVVPYKSV
MSAFSRICHEEGVRGLYSGILPSLAGVSHVAIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEV
IRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVPPETNRSDDR
RREEERKNLVSRRGEEEDKDLGLRESQTQSNKISTPHIPLGSK