TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8S3X4|Q8S3X4_CHLRE Putative c-type cytochrome biogenesis protein OS=Chlamydomonas reinhardtii GN=CCDA PE=2 SV=1
MRTAMHLAQPQCHTNLYALPSRQLALFKPCPVRVASSKSLKRQLRAVSGQELYELSDQAQDLVQGLFAAGQSADALVSQQ
LTGVTPLTYLAVLGAGLVTSLSPCTLSVLPLTIGYIGGYSQDDNGNGASKPNLGLQAVSFSFGLATTLAVLGVVSSFLGR
AYGQIGNELPITVGLVAVLMGLNLLEVVQLQLPSLMPDVDVRKAPVPPALQAYLAGATFALAASPCSTPVLATLLAYVSS
TRDPLEGGSLLLAYTCGYVAPLLLAASFTGTVKQLLALRQYSAWVTPASGVLLVAGGTYTLLSRLVPS