TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TN67|Q8TN67_METAC Amino acid permease OS=Methanosarcina acetivorans GN=MA_2426 PE=4 SV=1
MVISMDDNTHSSQIDWQYAEECSRASCDLKELERSIDWKQGLAIALGVPLLILPSIGYFTGYVWAFSIIIWALTIFLGFF
QNLAFGELATVFPKASGLPGYTQTVFGSSSNSNNKGKFKFGKFIGGFSAWSYWFGWSPVLAIYAILIGSYLKGLVPAFSG
VPDTLLSLMVGALIFGSLAIINSKGLKNGAMAGYILAVVSLIPLIVITVAPFLTGDFHLANITSSWFPTDWTWDMKHILI
LFGIFAMAEWSACAWETAAIYGPEYKNPNTDTPKALLVCGGICLVLYVLVQTSVIGTLGVEGVLSEPISPMLPIANLTLG
ALGASIAIIMLVGAMLLIIQTAFLSSARSIYSMSTEGNLPAVLSKLNSHGHPMNAMIADALFNMGLILLGTPTAILAASA
IGYIFANGISLYTYVKVRNDPKLSKLDRPFKAPNGWKNVAMATAILNIPFFLVGIIYLNSLELGWATTGVGFFVLCLYVP
LWFYSQRETRKTEEKMAAEKEAVIV