TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8U1J4 Oligopeptide ABC transporter (ATP-binding protein) - Pyrococcus furiosus.
MLELENVTKTFTSGLFGGYEIRAVDGVSFKVEEGEIVSLIGESGSGKTTIGKLILRLIKPTSGRILFKGEDIWSFDKERL
RRYYYKNVQAVFQDPFASFNPLHKVDRVFDLVFKNFLGNVGEEEKKEMIKRSLESVGLNPSEVLGKYPHQLSGGQLQRIL
IARALLVEPSLLIADEAVSMLDASTRIDILNLLGEFRDRVGTSVIFITHDLALGYYISDKVVIMYRGRIVEWGDAEKIFN
NPLHPYTRMLLESVPDLNVKWEFKGIEPEREEEGIYEIQGCRYAPRCPYAREECYKKPPQTTQPEKNHHVACYLYK