TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8U1J6 Dipeptide ABC transporter, permease protein - Pyrococcus furiosus.
MPVGKSKFEVLKIALKNIKFKVGLGIVIFFALFAIIGPLLVPFDNMGYYPIKVGDRVIPKPTEPALPPGSLSKVFTPNGT
VEVKHYLGTDSFGRDVYAQLTYGLRSSLIVGLLAGSIATAIGLLIGFIAGYKGGLVDEILMMITNIMLVIPTMALLIIIA
AYLPYRGIGIESVIIGLTAWPWTARAVRAQTLSLKRREFVDLSKLSGQSDLQIIFGEILPNMVSYVFMVFILQFSGAILA
AVGLDFLGLGPTKGMSLGIMLQMAVLWNAINLGYWWWAIPPGLVIAILITGLYMINLGLEEVFNPRLRRE