TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8U1W2|Q8U1W2_PYRFU Uncharacterized protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1092 PE=4 SV=1
MEAFQKVLWGIKKMKALGGVIWYHVNLTMRNIRYWITTLTFAIFIFYLWHKGAIFDDPSVFVTLGIAVLMYSHLFNPVKI
GKLLYYKPNSGAIAILISIIATFPVIFMFSYVYPNSFLLNFVVFSLLALLPLSTSLRLRMGISLFGAFLLLILDKKNMLI
GYFVLLALYLTVIVIKNRMVGVYFVGSSYISTLSAEVRLLLLIFSVAYIVVVGYIESLGIPFRCGFWECETRWPPWVILD
PRNYIYVKITAILAAICLSTPLLWPFLLGIDYYMDYHLIYLHYLRPEGYLRRLFKEVVLFSLSLILPIIFYSSSISVNTL
AGLIITFGFARVVMSLILTNFEDNAFLVLYSIIVVAPFIWAKFFSPWLAIIGVFLAPLAYKVRLQLEGE