TCDB is operated by the Saier Lab Bioinformatics Group
>Q8U4K5|Y080_PYRFU UPF0100 protein PF0080 - Pyrococcus furiosus.
MREGGVMKKRLLALIVAFAVLTAGCLGSESKEVTLIVFHAGSLSVPFQEVEKEFSEYAERNLGIKVSFQDEASGSVMAVR
KVTDLGRKADVIGVADYTLIPQLLIPNYTDFYVLFATNEIVIAFTDKSRYVEEMKSNPDKWYEILAREDVRFGFSDPNQD
PCGYRSLMVIKLADLYYGKEIFKELIEENTNIYSNGTQIYAPKEITVNPGKIVIRPKETDLLGLVESGSIDYIFIYKSVA
KQHNLSYITLPSEINLGDFSKEKFYGQISITLGSTGKTIKAKPIVYGVTVLKDAPNREVAIEFLRYLLSENGKRIFEKNH
QDFLEPPIAFGNVPEELKPLVSIEK