TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VYR7 Putative anion exchange protein (BOR1 protein) - Arabidopsis thaliana (Mouse-ear cress).
MEETFVPFEGIKNDLKGRLMCYKQDWTGGFKAGFRILAPTTYIFFASAIPVISFGEQLERSTDGVLTAVQTLASTAICGM
IHSIIGGQPLLILGVAEPTVIMYTFMFNFAKARPELGRDLFLAWSGWVCVWTALMLFVLAICGACSIINRFTRVAGELFG
LLIAMLFMQQAIKGLVDEFRIPERENQKLKEFLPSWRFANGMFALVLSFGLLLTGLRSRKARSWRYGTGWLRSLIADYGV
PLMVLVWTGVSYIPAGDVPKGIPRRLFSPNPWSPGAYGNWTVVKEMLDVPIVYIIGAFIPASMIAVLYYFDHSVASQLAQ
QKEFNLRKPSSYHYDLLLLGFLTLMCGLLGVPPSNGVIPQSPMHTKSLATLKYQLLRNRLVATARRSIKTNASLGQLYDN
MQEAYHHMQTPLVYQQPQGLKELKESTIQATTFTGNLNAPVDETLFDIEKEIDDLLPVEVKEQRVSNLLQSTMVGGCVAA
MPILKMIPTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRFKVLEDYHATFVETVPFKTIAMFTLFQTTYLLICFGL
TWIPIAGVMFPLMIMFLIPVRQYLLPRFFKGAHLQDLDAAEYEEAPALPFNLAAETEIGSTTSYPGDLEILDEVMTRSRG
EFRHTSSPKVTSSSSTPVNNRSLSQVFSPRVSGIRLGQMSPRVVGNSPKPASCGRSPLNQSSSN