TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8WVX3|CD003_HUMAN Uncharacterized protein C4orf3 OS=Homo sapiens GN=C4orf3 PE=1 SV=2
MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP