TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8XGV9|Q8XGV9_SALTI Putative membrane protein OS=Salmonella typhi GN=STY3230 PE=4 SV=1
MARRPFSSQSLVLIVIAIAINMIGGQLISMLKLPIFLDSIGTLISAVLLGPFIGMLTGLLTNLLWGLLTDPIAAAFAPVA
MVIGLVAGWLARAGWFRTLPKVIVSGVVITLAVTLVAVPLRTALFGGVTGSGADLFVAWMHSMGQNLVESVAITVIGANL
VDKILTAIIVWVLLRQLPLRTTRHFPAMSAVR