TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8XT32|Q8XT32_RALSO Probable dna-damage-inducible f transmembrane protein OS=Ralstonia solanacearum (strain GMI1000) GN=dinF PE=4 SV=1
MEHSSAIPVAPGRPMQWHRRVLALAFPIVLANLTQPLLSAVDTAVAGHLPGPEYLGGVALGGVFFNFVFWGFGFLRMGTT
GLVAQAHGAGDARGLRANVARALLLALGIGLALLVLQGPAIRFTLALLGASDAVTRMAGIYCHARIWSAPFALANYVVLG
TLLGRQQVRLALLLQVFINLVNMVAVLGLVLGAGMGVGGIGAATAVADILGFALGMALLRLLSRDGMRGLPPMTRAELLA
RDAWRRLMGLNADIFLRTACLLAAFGWFAHAGAQQGDVILAANALLLNFLTFMAYGLDGFAHAAEALVGAALGARDGRAL
RSAIRVSTLWSVLGAALFSLVYAVAGSVIIGWLTDQPAVREAARHALVWAALLPVVSVWGFQFDGVFIGATRTRELLLTM
AFSALVFGLLAVALLPRWGNPGLWFAMLAFMALRGMTLGMLLPRVLNAAPAASPQAA