TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Y5F0|Q8Y5F0_LISMO Lmo2114 protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2114 PE=4 SV=1
METVLQAKNVRKIYGSKGNVYTALENISIDIKEGEFTGIMGPSGAGKSTLLNVLSTIDKPTSGQIVISGQELENMNEQQM
STFRRDKLGFIFQDYNLLDTLTIRENIILPLALAKRPVKEMEEKLAIISEKFGITEILDKYPSEISGGQKQRTAASRAII
TSPSLIFADEPTGALDSKSATNLLESLRDLNEQDKSTIMMVTHDAFAASFCKRILFIKDGELYTEIYRGTKTRKEFFQKI
LDVLAKLGGDSDDVI