TCDB is operated by the Saier Lab Bioinformatics Group
>Q8YUK6|Q8YUK6_ANASP Alr2338 protein - Anabaena sp. (strain PCC 7120).
MGRFEKRPDNDPRVRGELSRAAETALWAVVEDLESLQQNVLRSFQEEIKKLQTEKDRLTDEVQQLIEEKEHLQEVRRITE
QQVLIRQLSEALAKHICSQLQSSLAKIANQTESQIAALKSAQSIGPAIENNEQVEKMLGSLDDNLTIAFNSLQQELKNYQ
SNLSQQLSRMYNQQQQGETIVEELIDRLRGELTRAIQETSTAKAQLSPPTVLQPPELQPPSSPVVVNLSPPTVLQFPDQQ
SPNPLQASTPLEETSTTKPSVSITPPEKSTPVTIVPPPQETRPETKSVIPKVSPDSETKLQSSQEKAAEPSSVINRELSA
GAAKSPLTPEKPPEPISTSKTKFSPSSEKPPEPISTSKTKFSPSSEKPPEPVSVLSRDSSASKASTPPPAPVVRRGSTPS
SSRSRKSSNLSPVQVGFLLVVLSTVMTALYNVVLKGMFYKTSQLSAMLEVAGLISPTLGNIMLILTLRLMVVVPLMILLA
PMMYPQVWQDLQNLKQSLGNNQSGSRSQPQRFVQLMFASGCFLFLSQVLIYLAIGQVPTGVAIALFFVYPLINGVLSWLL
FRDRPGVFRASAIGAIFCGEVLVFAGATSTGIGTTPLGSITAILAGAAFACYLILTRVCAAKVHPVSLSLINFVTMLGLS
FIFLMIPLPENWSLVVDPSKLLEIVLSAFILGALTLLSYVFSHIGINKLGGLRSAIISASVPILTVILAGLVLQETLNIA
QIFGVLFVTFGAIAFGIGKIQNPNKPANAEG