TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Z3V8|Q8Z3V8_SALTI Possible ABC-transport protein, ATP-binding component OS=Salmonella typhi GN=STY3232 PE=3 SV=1
MDMVTLEQFRYLPSDATRPPACFDFHYSTPGIVAIVGDNGSGKSTLAQLMAGWYPDYLPGDIDGTGLLLGVPIGRLPLVE
QSPTIHLVQQSPYLQLSGCTFSVEEEVAFGPENLGLHEAEILRRIDEALTLTNCQSLRHRHPGTLSGGETQRVVIASALA
MQPRLLVLDEAFSRLTSAATGTLLERLQQWALERHSLIVLFERNHFPFLTRCQRVWQLRNGALTPLC