TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Z3V9|Q8Z3V9_SALTI Putative membrane protein OS=Salmonella typhi GN=STY3231 PE=4 SV=1
MAACTTLLLPAQTVFPVYSAAAFLCLLALKSTRRRAKYVAWLMLSLGFGLWLVHGGWLTEWISGQPRDPQRWVYAVTLWL
RLLAIVSTSQLWMQYVPVQRFIRALFASRLPPGIAYLFAGPLLVVEQLKRQLTIVHEAQRARGVPLDEGWYQRLRAMPAL
IVPLTQNALNDLTIRGAALDMRGFRLHRARTTLWAPKDSMLQRVARYGMVLLILAEAGVWIWLR