TCDB is operated by the Saier Lab Bioinformatics Group
>Q8ZRG9|Q8ZRG9_SALTY Putative cation efflux system protein - Salmonella typhimurium.
MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTVQVSASYPGANPQVIADTVAAPLEQVINGVDGMLYM
NTQMAIDGRMVISIAFEQGTDPDMAQIQVQNRVSRALPRLPEEVQRIGVVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFA
IRQVRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSVGQQPEASAAFQMTVNTLG
RLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRSLLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFP
QDIEYRIAYDPTVFVRASLQSVAITLLEALVLVVLVVVMFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFGL
VLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSAFLAGLQGEFYRQFALTIAISTI
LSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTVTGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGL
TWLGFHQVPNGFVPAQDKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSALMFAML
KPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIEDRAELGFEAMTKVQSEIMSKAMQTPE
LANMLASFQTNAPQLQVDIDRVKAKSMGVSLTDIFETLQINLGSLYVNDFNRFGRAWRVMAQADAPFRMQQEDIGLLKVR
NAKGEMIPLSAFVTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDLVYQEKQAGN
SALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGGDNNIFTQIGFVVLVGLAAKNAILIVEFARA
KEHDGADPLTAVLEASRLRLRPILMTSFAFIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRM
ALKRENRVDSHDQQA