TCDB is operated by the Saier Lab Bioinformatics Group
>Q8ZRH0|Q8ZRH0_SALTY Homology to outer membrane efflux protein - Salmonella typhimurium.
MRTALIRMISKHNDGNGIMKITFTGYRQTATLATLAFVTTLAGCTMAPKHERPASPTAMVYPYATSTVSGAPDAADIGWR
DFFHDPLLQELIAIALRNNRDLRKAGLNVEAARALYRIQRAEMLPTLGIATAMDASRTPADLSVMDESEINRRYEAAGAT
TAWELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLAAQKSSYTLTTQLARTGNA
TQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDIR
AAEYRLRGANARIGAARAAFFPTISLTGSAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEIA
RYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTLLDTHRMLYGAQQRLVRTRLMQQ
LNIINLYKALGGGWREYSEKKQG