TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q92Q38|Q92Q38_RHIME Putative outer membrane secretion protein OS=Rhizobium meliloti GN=tolC PE=4 SV=1
MVSIVRKAALWAAVSTSVLLAPHAVLAETIFGAMAKAYANNPDLNAARAGLRATDEGVPIAKAGYRPQISASATGTLSRV
DAERTGTRDFHSGQVGISITQTIFDGFQTLNNVRAAQADVFSSRETLKANEIQILLSAAQSYANIARDQQVVSIRRQNLA
FLREQLSAAQARLEVGEGTRTDVSQAEAELANAQSLLVAAIAQLKQSEAVYVQIVGAAPTGIRQPGPATKAMPRSLDQAV
ATGLRENPQILAAQYAVDSAGYQVKSAEGTMLPGVVLQGAVSRNTGNAGQGLDDTTASVTARLEVPIYQGGAEYGQIRQA
KEILGQQRILVDSARASVQQTVVSAHAQLESALARIRASRSQIAAANLALEGVVEERKVGQRTTLDVLISQQDVLDAQEA
LAGAQRDAVVASYALLAAMGHLTVRSQGLQVAEYRAEEHYEAVKDKWFGLRTVDGR