TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93K41|Q93K41_KLEPN AcrA protein OS=Klebsiella pneumoniae GN=acrA PE=3 SV=1
MNKNRGLTPLAVVLMLSGSLALTGCDDKPAQQGAQHMPEVGIVTLKSAPLQITTELPGRTSAYRIAEVRPQVSGIILKRN
FVEGSDIQAGVFLYQIDPATYQGSYDSAKGDLAKAQAAANMDQLTVKRYQKLLGTQYISQQDYDPAVATAQQNNAAVVAA
KTAVETARINLAYTQKSPLRSAAGSGKSPVTEGALVQNGQTTALATVQQVDPIYVDVTQSSNDFLRLKQELADARLKQEN
GKAKVELVTNDGLKYPQSGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGINPDALLVPQQGVTRTPRG
DASVMVVGEGDKVEVRQVTASQAIGDKWLVTDGLKSGDRVIVTGLQKIKPGVQVKAQEVASDDKQQAAGNAPSEQTKS