TCDB is operated by the Saier Lab Bioinformatics Group
>Q93PU3|TTGI_PSEPU Toluene efflux pump outer membrane protein ttgI - Pseudomonas putida.
MKFKSLPMFALLMLGGCSLIPDYQQPAAPMQAQWPTGQAYGGQGDQRSIATALPKAKEFFKDPALVRLLDAALENNRDLR
IAAKNVESYRALYRIQRAERFPTLDGQASGNRTRLPDDLSPTGDSRIDSQYQVGLVTAYELDLFGRIRSLSNQALEKYLA
TEEAQRSVQIALIGDVATTYFLWRTDQALLELTEATLTSYVESLAMIESSAWAGTSSELDVRQARTLVNQAQAQQALYTR
RIAQDVNALELLLGSKIPTDLPKNSPLAMSALGKVPAGLPADLLLNRPRIRSAEHQLMAANANIGAARAAFFPRISLTAS
AGSASSDLDGLFNSGSDSWSFAPQISVPIFNAGKLRANLDYAELQKDVGVATYEKSIETAFREVADGLAARGTYGKQLSA
QSELVDNYKAYFSLAQQRYDQGVDSYLTVLDAQRELFSSQQKLLNDQLDQINSEVQLYKALGGGWSVSQN