TCDB is operated by the Saier Lab Bioinformatics Group
>Q93PU5|TTGG_PSEPU Toluene efflux pump periplasmic linker protein ttgG - Pseudomonas putida.
MRAERWSQTVRQIRSPRALRVIPLTALMLISGCGEKEQVSSATPPPDVGVYTVRAQALTLTTDLPGRTSAFRVAEVRPQV
SGILQKRSFVEGAEVKLGQQLYQIDPRTYEAQLRRAEANRTSAQNLARRYETLLKTKAVSKQQYDDALAAWKQAEADYQV
ARIDVQYTRVLSPISGRIGRSTVTEGALVTNGQAQSLATVTQLDPIYVDVTQPITKLLGLHKALESGRLQKTGENQAEVS
LTLDDGSAYPLPGTLKFSEVSCDPTTGSVTLRAEFPNPNRKLLPGMFVHALLKEGVQNAAILVPQQAISRDTRGVPSVWV
MKADNTVESREIQTLRTVGNAWLISNGVTEGERIITEGVQRVRSGIAVNAVEAKNVNLVDGFAATTEASAN