TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
MADAWKDLASGTVGGAAQLVVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASEGTKGLYKGMGAPLATVAAFN
AVLFTVRGQMEGLLRSEAGVPLTISQQFVAGAGAGFAVSFLACPTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVA
RHVLRSEGGARGLFKGLFPTFAREVPGNATMFAAYEAFKRFLAGGSDTSSLGQGSLIMAGGVAGASFWGIVYPTDVVKSV
LQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACFLAYEMTRSSLG