TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1
MEPADLSNLRGRSLRASIRGSMRGSIRENSNSIWRNNGAEVFSRSARDEDDEEALKWAALEKLPTYDRLRKGILFGSQGA
AAEVDVDDSGVLERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDFPSIEVRFEHLNIDADAYVGSRALPTFTNFISNF
VEGLLDSIHILPSKKRQVTILKDVSGIVKPCRMTLLLGPPGSGKTTLLLALAGKLDSALKVTGKVTYNGHELHEFVPQRT
AAYISQHDLHIGEMTVRETLEFSARCQGVGSRYEMLAELSRREKAANIKPDADIDMFMKAASTEGQEAKVVTDYILKILG
LDICADTMVGDQMIRGISGGQKKRVTTGEMIVGPSKALFMDEISTGLDSSTTYSIVNSLKQSVRIMKGTALISLLQPAPE
TYNLFDDIILLSDGYIVYEGPREEVLEFFESMGFKCPERKGAADFLQEVTSKKDQQQYWIRRDEPYRFITSKEFAEAYQS
FHVGRKVSDELKTTFDKSKSHPAALTTQKYGIGKRQLLKVCTERELLLMQRNSFVYLFKFFQLLIIALMTMTIFFRTKMP
RDSAEDGGIYSGALFFVVIMIMFNGLSELPMTLYKLPVFYKQRDFLFYPSWAYAIPSWILKIPVTFAEVGMWVFLTYYVM
GFDPNVGRFFKQFLLLLLVNQMASALFRFIAAVGRTMGVASTFGAFALLLQFALGGFILARNDVKDWWIWGYWTSPLMYS
VNAILVNEFDGQKWKHIVAGGTEPLGAAVVRARGFFPDAYWYWIGVGALAGFIVMFNIAYSVALAYLNPFDKPQATISDE
SENNESESSPQITSTQEGDSASENKKKGMVLPFDPHSITFDEVVYSVDMPPEMRESGTSDNRLVLLKSVSGAFRPGVLTA
LMGVSGAGKTTLMDVLAGRKTGGYIDGSIKISGYPKKQDTFARISGYCEQNDIHSPYVTVFESLVYSAWLRLPQDVNEEK
RMMFVEEVMDLVELTPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGR
TVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRQSCHLIKYFESIPGVSKIVEGYNPATWMLEVTASSQEMALGVD
FTDLYKKSDLYRRNKALIDELSVPRPGTSDLHFDSEFSQPFWTQCMACLWKQHWSYWRNPAYTAVRLIFTTFIALIFGTM
FWDIGTKVSRNQDLVNAMGSMYAAVLFLGVQNSSSVQPVVSVERTVFYREKAAGMYSAIPYAFAQVLIEIPYIFVQATVY
GLIVYSMIGFEWTVAKFFWDFFFMFFTFLYFTFFGMMTVAVTPNQNVASIVAGFFYTVWNLFSGFIVPRPRIPIWWRWYY
WGCPIAWTLYGLVASQFGDLQDPLTDQNQTVEQFLRSNFGFKHDFLGVVAAVIVAFAVVFAFTFALGIKAFNFQRR